Skill 18 · Hyperframes Animation
Subchapter 18.35
blueprints/prompt-type-submit-generate.mdMarkdown18 KBView on GitHub
intent: The AI-era demo shot — a [prompt / query / command] types character-by-character into a REAL product input (chat composer, search bar, terminal prompt, URL bar, sidebar assistant) and the machine answers: status theater into a streaming answer / agent action log / diff cards / chart / generated artifact — or the clip cuts at the submit and the ask itself is the show. The keyboard is the actor and the product is the responder. Distinct from (a line typed as bare typography on an empty field — no product surface, nothing answers) and from (a cursor clicking a reconstructed UI through states — there the pointer drives every change; here any cursor work only primes the input or lands the submit, and every state change after that is the machine’s own doing).
typewriter-revealcursor-ui-demoroles served
app-window-push-in-prompt-typing): when the opener is “watch me ask” — typed headline beat(s), ONE eased push-in lands tight on the product’s input, the prompt types and the clip ends at / just after submission (sub-shape A).typed-command-output-scroll): when the demo loop ITSELF is the hook — command in, output builds and scrolls, and a second command / retype starts before the cut, ending mid-action (sub-shapes B/C with the restart ending).prompt-typing-composer): when the first look at the product IS its composer — a brand beat opens onto the input surface, a long prompt types with hovers / attachments / dropdown picks, and the camera steers gently toward the input or the confirming control (sub-shape A, occasionally running through to an agent-log payoff).search-query-walkthrough): when the product is introduced through its search affordance — a short [query] types with a blinking caret, autocomplete / results populate LIVE, and a confirm click settles the result state (sub-shape C, search skin).prompt-type-submit-generate): when the capability is demoed as ONE prompt→response round trip — submit into thinking/status states, then a streaming answer, action-log rows with brand icons, green diff cards, a chart drawing itself, or an instant generated-app reveal (sub-shapes A/B/C — the family’s widest role).install-command-end-card): the install-command end card — the closing [headline] DEMOTES (shrinks, grays, lifts) to make room for a [terminal pill] that springs in and stretches wide, the [install command] types out with a blinking cursor, flanking metadata and a [tool-icon row] pop in, and the finished card holds long. No submit, no response — the typed command IS the ask (sub-shape A, terminal skin).duration: 5.2–12s (A prompt-as-hook 5.2–12s, incl. the ~7.4s CTA end card; B full generate loop 5.45–11.9s; C instant-result surface 5.7–11.9s — a long-form family: most members run 7–12s because the response needs room to arrive)
shot structure (a [product input] on/inside a [product surface — app window, web page, terminal, browser chrome, sidebar] over [bg color]; the input is the gravitational center — the camera makes at most one or two purposeful moves toward or away from it and is otherwise LOCKED; typing is character-by-character behind a visible caret, and response content arrives progressively, never dumped; three folded sub-shapes — (A) prompt-as-hook: the clip ends at / just after the submit (or mid-word), the ask is the show; (B) full generate loop: submit → status theater → the output builds block by block; (C) instant-result surface: the machine answers with a finished surface, often re-queried before the cut)
Scene 0 (optional, 0.0–~2s) — lead-in beat. ONE establishing move before the input owns the shot: a [headline] types on centered and clears; a [title card] hard-cuts away; a brand beat ([logo/mascot] centered, [serif title] building in word groups, logo shrinking-and-rising to dock top-center); an [orb / mark] forms with a glowing rim; the [app window] flies in with motion blur and settles; or a full-frame [thumbnail grid] parts at its vertical centerline to clear the stage. Keep it ≤2s — the input is the star.
[tagline] typing in the identical style; the typing register is established before the product ever appears.[closing line] types on in two steps (“[Designed.] [Not generated.]”) and holds — it will demote in Scene 2.Scene 1 (~1–3s) — the input takes focus. The [product input] arrives or is primed: a [pill bar] EXPANDS sideways from the mark/chip; a [prompt palette / card] SPRINGS in at center with a soft shadow; ONE smooth eased/accelerating push-in crops tight onto the composer inside the [app window] (headline chrome slides out of frame); a [⌘K search modal] springs to center while the page blurs behind it; a cursor clicks a [menu row / Assistant button] and the prompt block appears; or a [✕ clear button] empties the previous query back to [placeholder]. Optional composer ritual (pick 1–2, before or during typing): an [attachment] drags in and settles in a tray below the input; a [model / option dropdown] opens beneath the selector, rows hover-highlight, a checkmark lands and the toolbar label updates.
[chip grid] fades in and the cursor arcs across 2–3 hover highlights before clicking the one that opens the composer; the affordances are the tour.[query] and its previous [result panel] — clearing it says “this is a working tool, not a mockup”.Scene 2 (~2–6s) — the prompt types (the engine). The [prompt text] types rapidly character-by-character behind a blinking caret; the input card GROWS downward / wraps as text fills, pushing footer controls and attachments down; a typed [token] may convert into an inline [brand pill] mid-typing ([@browser] → a colored [Browser] chip, typing continues around it); the camera may run ONE slow continuous push-in toward the input, decelerating to a near-hold on the typed ask. Sub-shape (A) may END here — cut mid-word with the caret blinking, or held on the finished prompt.
[option pills] cascade in above it; the prompt is still mid-word at the cut — the product is introduced as something you talk to.[$ chip] spring-pops below and STRETCHES horizontally into a wide [terminal pill]; the [install command] types out inside it; a faint [repo link] and a “[Works with]” label fade in quietly; a row of [tool icons] pops in one after another with soft spring scale; the finished composition holds long, only the caret blinking.Scene 3 (~4–7s) — submit + machine theater. The [submit control] is clicked (cursor glide + press dip; the button may have MORPHED state on first keystroke — waveform → up-arrow — and may flip to a [stop] control while streaming) or the retype implies enter. The surface answers instantly with a working state: prior content VANISHES (chip grid gone, panel collapses to its slim header, whole layout swaps); then the theater — [status phrases] cross-dissolve with a left-to-right shimmer sweep (“[Thinking]” → “[Modeling…]” → “[Planning…]”), a [spinner] rotates over a loading strip, a row of [loading cards] lines up, or a [checklist] populates and its items flip one by one to green checks with strikethrough while a [status heading] flips tense (“[Using X]” → “[Used X]”).
Scene 4 (rest) — the answer arrives. Choose by sub-shape:
[answer text] streams paragraph by paragraph; [action-log rows] pop in sequentially, each with a [brand icon]; [diff cards] expand with green-highlight added lines; [chart lines] draw staggered left-to-right from a shared origin; an [ASCII / summary table] draws in; live counters tick; the surface auto-scrolls vertically to follow the newest line (page, terminal, or in-card scroll) — often under ONE slow continuous push-in on the result window.[result / article] renders in place; [autocomplete chips] stagger-pop below the bar WHILE the query types (the machine answers every keystroke), then a hover fills the [Search button] solid and a click confirms; the [generated page] rises as a rounded card and SCROLLS continuously beneath the pinned prompt; a blur-whip resolves onto the [artifact window] and a tab click FLIPS code → preview; or a zoom-out reveals the prompt pill was inside a full [workspace] where the [content] rewrites itself live.Scene 5 (final beat) — resolve. Diverges by role and sub-shape:
[action buttons] fully rendered; no fade-out, no blank end frame.[Create PR] / [Generate] / [Search]) as the clip ends, or extras fade and a final push-in leaves the clean end state; one member hard-cuts to a minimal [end card] — the submit button alone at dead center with a settle pop.[prompt / command] starts typing at a fresh prompt line, or the query BACKSPACES-AND-RETYPES and the output swaps wholesale to [result 2] — the clip ends MID-ACTION, mid-scroll or mid-word: the loop is endless, and that is the point.motion vocabulary: character-by-character typing with blinking caret / block cursor; typed-headline beats replacing each other; input pill grows / wraps downward into a multi-line box; prompt palette / card springs in; pill bar expands sideways from a mark or chip; orb formation with glowing rim; typed token → inline brand-pill morph mid-typing; placeholder clear; ✕-click query clear; backspace-and-retype query swap; attachment drag-in and tray settle; dropdown open + row hover-highlight + checkmark select + toolbar label update; chip-grid hover dance; cursor glide / arc with hover highlight fills; click press dip; submit-button state morph (waveform→up-arrow, submit→stop); hover fill-state swap on a Search button; content vanish / panel collapse / layout swap on submit; status-phrase cross-dissolves with left-to-right shimmer sweep; pulsing “Thinking”; spinner rotation; loading strip; animated trailing dots; loading model-card row; status-heading tense flip (Using→Used); checklist squares flipping to green checks with strikethrough; action-log rows popping in sequentially with brand icons; streaming text blocks pushing content down; green-highlight diff cards expanding; staggered left-to-right chart line-draws; ASCII / summary table draw-in; count-up ticker; vertical output scroll (page / terminal / in-card) following the newest line; generated page rising as a rounded card and scrolling beneath a pinned prompt; autocomplete chips rapid stagger-pop; code↔preview instant flip on tab click; blur-whip transition; prompt jumps to a heading on submit; zoom-out reveal from prompt pill to full UI window; single eased / accelerating push-in landing on the input; slow continuous push-in on the result window; window fly-in with motion blur; zoom + pan cropping browser chrome; ⌘K modal spring-in with background blur; full-frame grid parting at the vertical centerline; headline demotion (scale-down + desaturate + lift); chip horizontal-stretch into a wide terminal pill; quiet low-contrast metadata fade-ins; sequential spring pop-ins of an icon row; second prompt typing at the cut; interface dim / fade at the cut; long static end hold with blinking cursor.
rule mapping
discrete-text-sequence (typing / typos / holds / backspace) backed by gsap-effects (typewriter recipe)context-sensitive-cursordynamic-content-sequencinganchored-layout-expand (top-anchored downward growth, stepped at wrap boundaries)scale-swap-transition (token→chip swap at the conversion threshold) + card-morph-anchor (the reflow around the chip)spring-pop-entrance (single hero or staggered group)card-morph-anchor (container morph)cursor-click-ripple; the press dip + recovery → press-release-spring (or physics-press-reaction for cursor+button compressed together)asr-keyword-glow (static-timeline glow variant) or press-release-spring (color-transition variation)context-sensitive-cursor (pointer↔grab) + spring-pop-entrance (tray settle)scale-swap-transition (paired same-center swap) or a hard tl.set state swap via discrete-text-sequence semanticshyperframes-keyframes (FLIP); the travel itself via nudge-curve (slow-fast-slow group slide)discrete-text-sequence (phrase swaps) + ambient-glow-bloom (Shimmer sweep variation — single-pass traveling sheen, clipped to the text)svg-icon-enrichment (rotating / pulsing internal SVG elements); the bounded “Thinking” pulse → sine-wave-loop (finite repeats — this pulse PERFORMS status, it is not idle wobble)discrete-text-sequence (discrete state stepping); the checkmark stamp → svg-path-draw or spring-pop-entrancedynamic-content-sequencing (per-block windows) + spring-pop-entrance (per-row arrival)viewport-change counter-pan when the frame itself travels3d-page-scroll (flat variant — internal scroll of a page card)svg-path-draw (stroke-dashoffset, staggered starts)counting-dynamic-scale; result bars / fills → stat-bars-and-fillsmulti-phase-camera (push phase) with the destination framed via coordinate-target-zoomviewport-change (composite pan+scale on the .world wrapper)motion-blur-streakdepth-of-field-blur (blur the page plane, keep the modal sharp) + spring-pop-entrancecenter-outward-expansion (halves glide outward in lockstep)ambient-glow-bloom + spring-pop-entrancegsap-effects (plain composite tween; no dedicated rule needed)context-sensitive-cursor (the blink is the sanctioned residual motion)camera modifier (the camera always serves the ask or the answer; many members are fully camera-static — typing, submit theater, and streaming carry the shot)
multi-phase-camera (push) + coordinate-target-zoom (target the input) — the defining move of the “watch me ask” opener.multi-phase-camera — gives the response weight without stealing from it.viewport-change (pull-back) — the inverse move; the ask was closer to the product than you thought.motion-blur-streak), zoom + pan cropping browser chrome (viewport-change) — both settle before typing starts.